BTNL3 anticorps (N-Term)

N° du produit ABIN635769

Détail du produit anti-BTNL3 anticorps

Antigène: BTNL3 (Butyrophilin-Like 3 (BTNL3))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp BTNL3 est non-conjugé

Application: Western Blotting (WB)

Specificité: BTNL3 antibody was raised against the N terminal of BTNL3

Purification: Affinity purified

Immunogène: BTNL3 antibody was raised using the N terminal of BTNL3 corresponding to a region with amino acids EDWESKQMPQYRGRTEFVKDSIAGGRVSLRLKNITPSDIGLYGCWFSSQI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

BTNL3 Blocking Peptide, catalog no. 33R-2333, is also available for use as a blocking control in assays to test for specificity of this BTNL3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BTNL3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur BTNL3

Antigène: BTNL3 (Butyrophilin-Like 3 (BTNL3))

Autre désignation: BTNL3 (BTNL3 Produits)

Synonymes: anticorps BTNLR, anticorps Btnl1, anticorps butyrophilin like 3, anticorps butyrophilin-like 3, anticorps butyrophilin-like protein 3, anticorps BTNL3, anticorps Btnl3, anticorps LOC100586129

Sujet: The specific function of BTNL3 is not yet known.

Poids moléculaire: 52 kDa (MW of target protein)