FCRLA anticorps (Middle Region)
-
- Antigène Voir toutes FCRLA Anticorps
- FCRLA (Fc Receptor-Like A (FCRLA))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp FCRLA est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- FCRLA antibody was raised against the middle region of FCRLA
- Purification
- Affinity purified
- Immunogène
- FCRLA antibody was raised using the middle region of FCRLA corresponding to a region with amino acids PTLNPAPQKSAAPGTAPEEAPGPLPPPPTPSSEDPGFSSPLGMPDPHLYH
- Top Product
- Discover our top product FCRLA Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
FCRLA Blocking Peptide, catalog no. 33R-7389, is also available for use as a blocking control in assays to test for specificity of this FCRLA antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FCRLA antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- FCRLA (Fc Receptor-Like A (FCRLA))
- Autre désignation
- FCRLA (FCRLA Produits)
- Synonymes
- anticorps FCRL, anticorps FCRL1, anticorps FCRLM1, anticorps FCRLX, anticorps FCRLb, anticorps FCRLc1, anticorps FCRLc2, anticorps FCRLd, anticorps FCRLe, anticorps FCRX, anticorps FREB, anticorps BB219290, anticorps Fcrlm1, anticorps Fcrx, anticorps Freb1, anticorps mFREB, anticorps mFcrX, anticorps RGD1306176, anticorps Fc receptor like A, anticorps Fc receptor-like A, anticorps FCRLA, anticorps Fcrla
- Sujet
- Receptors for the Fc fragment of IgG, or FCGRs, are cell surface glycoproteins of the Ig superfamily (IgSF). These receptors mediate phagocytosis of IgG-coated pathogens and promote activation of effector cells, leading to inflammatory responses and antibody-mediated cellular cytotoxicity. FCRLA may be implicated in B-cell differentiation and lymphomagenesis.
- Poids moléculaire
- 41 kDa (MW of target protein)
-