FCRLA anticorps (C-Term)

N° du produit ABIN635774

Détail du produit anti-FCRLA anticorps

Antigène: FCRLA (Fc Receptor-Like A (FCRLA))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FCRLA est non-conjugé

Application: Western Blotting (WB)

Specificité: FCRLA antibody was raised against the C terminal of FCRLA

Purification: Affinity purified

Immunogène: FCRLA antibody was raised using the C terminal of FCRLA corresponding to a region with amino acids MPDPHLYHQMGLLLKHMQDVRVLLGHLLMELRELSGHRKPGTTKATAE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FCRLA Blocking Peptide, catalog no. 33R-6273, is also available for use as a blocking control in assays to test for specificity of this FCRLA antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FCRLA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FCRLA

Antigène: FCRLA (Fc Receptor-Like A (FCRLA))

Autre désignation: FCRLA (FCRLA Produits)

Sujet: Receptors for the Fc fragment of IgG, or FCGRs, are cell surface glycoproteins of the Ig superfamily (IgSF). These receptors mediate phagocytosis of IgG-coated pathogens and promote activation of effector cells, leading to inflammatory responses and antibody-mediated cellular cytotoxicity. FCRLA may be implicated in B-cell differentiation and lymphomagenesis.

Poids moléculaire: 41 kDa (MW of target protein)