SI anticorps

N° du produit ABIN635778

Détail du produit anti-SI anticorps

Antigène: SI

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SI est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: SI antibody was raised using a synthetic peptide corresponding to a region with amino acids NSVLFTTQNQTPNRFRFKITDPNNRRYEVPHQYVKEFTGPTVSDTLYDVK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SI Blocking Peptide, catalog no. 33R-6891, is also available for use as a blocking control in assays to test for specificity of this SI antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SI antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SI

Antigène: SI

Abstract: SI Produits

Synonymes: anticorps 2010204N08Rik, anticorps SI, anticorps Si-s, anticorps SUCIMAL, anticorps sucrase-isomaltase, anticorps sucrase isomaltase (alpha-glucosidase), anticorps SI, anticorps Sis, anticorps Si

Sujet: SI belongs to the glycosyl hydrolase 31 family. It plays an important role in the final stage of carbohydrate digestion.

Poids moléculaire: 209 kDa (MW of target protein)