TMEM48 anticorps (Middle Region)

N° du produit ABIN635788

Détail du produit anti-TMEM48 anticorps

Antigène: TMEM48 (Transmembrane Protein 48 (TMEM48))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMEM48 est non-conjugé

Application: Western Blotting (WB)

Specificité: TMEM48 antibody was raised against the middle region of TMEM48

Purification: Affinity purified

Immunogène: TMEM48 antibody was raised using the middle region of TMEM48 corresponding to a region with amino acids PPIIKYLALQDLMLLSQYSPSRRQEVFSLSQPGGHPHNWTAISRECLNLL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMEM48 Blocking Peptide, catalog no. 33R-7260, is also available for use as a blocking control in assays to test for specificity of this TMEM48 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM48 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMEM48

Antigène: TMEM48 (Transmembrane Protein 48 (TMEM48))

Autre désignation: TMEM48 (TMEM48 Produits)

Synonymes: anticorps 2810475A17Rik, anticorps AI450313, anticorps Tmem48, anticorps NET3, anticorps TMEM48, anticorps tmem48, anticorps wu:fk93f04, anticorps zgc:55636, anticorps Xndr, anticorps NDC1 transmembrane nucleoporin, anticorps NDC1 transmembrane nucleoporin S homeolog, anticorps Xrcc1 N-terminal domain containing 1, anticorps Ndc1, anticorps NDC1, anticorps ndc1, anticorps ndc1.S, anticorps Xndc1

Sujet: TMEM48 is a component of the nuclear pore complex (NPC), which plays a key role in de novo assembly and insertion of NPC in the nuclear envelope. TMEM48 is required for NPC and nuclear envelope assembly, possibly by forming a link between the nuclear envelope membrane and soluble nucleoporins, thereby anchoring the NPC in the membrane.

Poids moléculaire: 76 kDa (MW of target protein)