SLAMF6 anticorps (N-Term)

N° du produit ABIN635797

Détail du produit anti-SLAMF6 anticorps

Antigène: SLAMF6 (SLAM Family Member 6 (SLAMF6))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLAMF6 est non-conjugé

Application: Western Blotting (WB)

Specificité: SLAMF6 antibody was raised against the N terminal of SLAMF6

Purification: Affinity purified

Immunogène: SLAMF6 antibody was raised using the N terminal of SLAMF6 corresponding to a region with amino acids NFITWLFNETSLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQLSNLK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLAMF6 Blocking Peptide, catalog no. 33R-6685, is also available for use as a blocking control in assays to test for specificity of this SLAMF6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLAMF6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLAMF6

Antigène: SLAMF6 (SLAM Family Member 6 (SLAMF6))

Autre désignation: SLAMF6 (SLAMF6 Produits)

Synonymes: anticorps SLAMF6, anticorps CD352, anticorps KALI, anticorps KALIb, anticorps Ly108, anticorps NTB-A, anticorps NTBA, anticorps SF2000, anticorps KAL1, anticorps KAL1b, anticorps RGD1561848, anticorps SLAM family member 6, anticorps SLAMF6, anticorps Slamf6

Sujet: SLAMF6 is a type I transmembrane protein, belonging to the CD2 subfamily of the immunoglobulin superfamily. SLAMF6 is expressed on Natural killer (NK), T, and B lymphocytes. It undergoes tyrosine phosphorylation and associates with the Src homology 2 domain-containing protein (SH2D1A) as well as with SH2 domain-containing phosphatases (SHPs). It may function as a coreceptor in the process of NK cell activation. It can also mediate inhibitory signals in NK cells from X-linked lymphoproliferative patients.

Poids moléculaire: 34 kDa (MW of target protein)