ISLR2 anticorps (N-Term)

N° du produit ABIN635806

Détail du produit anti-ISLR2 anticorps

Antigène: ISLR2 (Immunoglobulin Superfamily Containing Leucine-Rich Repeat 2 (ISLR2))

Épitope: N-Term

Reactivité: Souris, Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ISLR2 est non-conjugé

Application: Western Blotting (WB)

Specificité: ISLR2 antibody was raised against the N terminal of ISLR2

Purification: Affinity purified

Immunogène: ISLR2 antibody was raised using the N terminal of ISLR2 corresponding to a region with amino acids PFHCGCGLVWLQAWAASTRVSLPEPDSIACASPPALQGVPVYRLPALPCA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ISLR2 Blocking Peptide, catalog no. 33R-7074, is also available for use as a blocking control in assays to test for specificity of this ISLR2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ISLR2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ISLR2

Antigène: ISLR2 (Immunoglobulin Superfamily Containing Leucine-Rich Repeat 2 (ISLR2))

Autre désignation: ISLR2 (ISLR2 Produits)

Synonymes: anticorps LINX, anticorps B930052A04Rik, anticorps Linx, anticorps Mbu-3, anticorps mKIAA1465, anticorps immunoglobulin superfamily containing leucine rich repeat 2, anticorps immunoglobulin superfamily containing leucine-rich repeat 2, anticorps ISLR2, anticorps Islr2

Sujet: ISLR2 is a single-pass membrane protein. It contains 1 Ig-like (immunoglobulin-like) domain and 5 LRR (leucine-rich) repeats. The exact function of ISLR2 remains unknown.

Poids moléculaire: 79 kDa (MW of target protein)

Pathways: Regulation of Cell Size