Glycoprotein anticorps

N° du produit ABIN635807

Détail du produit

Antigène: Glycoprotein

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Inconjugué

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Affinity purified

Immunogène: Glycoprotein antibody was raised using a synthetic peptide corresponding to a region with amino acids DENDWNEKLYPVWKRGDMRWKNSWKGGRVQAVLTSDSPALVGSNITFAVN

Information d'application

Indications d'application: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Glycoprotein Blocking Peptide, catalog no. 33R-1913, is also available for use as a blocking control in assays to test for specificity of this Glycoprotein antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPNMB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détail du antigène

Antigène: Glycoprotein

Synonymes: anticorps glycoprotein, anticorps Glycoprotein, anticorps transmembrane glycoprotein G, anticorps G, anticorps RVFV_sM_gp1, anticorps RABVgp4

Classe de substances: Viral Protein

Sujet: GPNMB is a type I transmembrane glycoprotein which shows homology to the pMEL17 precursor, a melanocyte-specific protein. GPNMB shows expression in the lowly metastatic human melanoma cell lines and xenografts but does not show expression in the highly metastatic cell lines. GPNMB may be involved in growth delay and reduction of metastatic potential.

Poids moléculaire: 60 kDa (MW of target protein)