BTN1A1 anticorps (N-Term)

N° du produit ABIN635808

Détail du produit anti-BTN1A1 anticorps

Antigène: BTN1A1 (Butyrophilin, Subfamily 1, Member A1 (BTN1A1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp BTN1A1 est non-conjugé

Application: Western Blotting (WB)

Specificité: BTN1 A1 antibody was raised against the N terminal of BTN1 1

Purification: Affinity purified

Immunogène: BTN1 A1 antibody was raised using the N terminal of BTN1 1 corresponding to a region with amino acids LPCRLSPNASAEHLELRWFRKKVSPAVLVHRDGREQEAEQMPEYRGRATL

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

BTN1A1 Blocking Peptide, catalog no. 33R-5259, is also available for use as a blocking control in assays to test for specificity of this BTN1A1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BTN0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur BTN1A1

Antigène: BTN1A1 (Butyrophilin, Subfamily 1, Member A1 (BTN1A1))

Autre désignation: BTN1A1 (BTN1A1 Produits)

Synonymes: anticorps BT, anticorps BTN, anticorps Btn, anticorps BTN1A1, anticorps TVC, anticorps butyrophilin subfamily 1 member A1, anticorps butyrophilin, subfamily 1, member A1, anticorps zgc:162154, anticorps BTN1A1, anticorps Btn1a1, anticorps btn1a1, anticorps zgc:162154

Sujet: Butyrophilin is the major protein associated with fat droplets in the milk. It is a member of the immunoglobulin superfamily. It may have a cell surface receptor function. The human butyrophilin gene is localized in the major histocompatibility complex (MHC) class I region of 6p and may have arisen relatively recently in evolution by the shuffling of exons between 2 ancestral gene families.Butyrophilin is the major protein associated with fat droplets in the milk. It is a member of the immunoglobulin superfamily. It may have a cell surface receptor function. The human butyrophilin gene is localized in the major histocompatibility complex (MHC) class I region of 6p and may have arisen relatively recently in evolution by the shuffling of exons between 2 ancestral gene families.

Poids moléculaire: 56 kDa (MW of target protein)

Pathways: Activated T Cell Proliferation