BTN2A1 anticorps (N-Term)

N° du produit ABIN635811

Détail du produit anti-BTN2A1 anticorps

Antigène: BTN2A1 (butyrophilin, Subfamily 2, Member A1 (BTN2A1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp BTN2A1 est non-conjugé

Application: Western Blotting (WB)

Specificité: BTN2 A1 antibody was raised against the N terminal of BTN2 1

Purification: Affinity purified

Immunogène: BTN2 A1 antibody was raised using the N terminal of BTN2 1 corresponding to a region with amino acids SVALVIHNITAQENGTYRCYFQEGRSYDEAILHLVVAGLGSKPLISMRGH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

BTN2A1 Blocking Peptide, catalog no. 33R-8900, is also available for use as a blocking control in assays to test for specificity of this BTN2A1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BTN0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur BTN2A1

Antigène: BTN2A1 (butyrophilin, Subfamily 2, Member A1 (BTN2A1))

Autre désignation: BTN2A1 (BTN2A1 Produits)

Synonymes: anticorps BK14H9.1, anticorps BT2.1, anticorps BTF1, anticorps DJ3E1.1, anticorps BTN2A1, anticorps btf1, anticorps bt2.1, anticorps BTN2A2, anticorps butyrophilin subfamily 2 member A1, anticorps butyrophilin subfamily 2 member A1 S homeolog, anticorps butyrophilin, subfamily 2, member A1, anticorps BTN2A1, anticorps btn2a1.S, anticorps btn2a1, anticorps LOC100409586

Sujet: This gene is a member of the BTN2 subfamily of genes, which encode proteins belonging to the butyrophilin protein family. The gene is located in a cluster on chromosome 6, consisting of seven genes belonging to the expanding B7/butyrophilin-like group, a subset of the immunoglobulin geneuperfamily. The encoded protein is an integral plasma membrane B box protein involved in lipid, fatty-acid and sterol metabolism.

Poids moléculaire: 57 kDa (MW of target protein)

Pathways: Activated T Cell Proliferation