GALNT5 anticorps

N° du produit ABIN635812

Détail du produit anti-GALNT5 anticorps

Antigène: GALNT5 (UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase 5 (GalNAc-T5) (GALNT5))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GALNT5 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: GALNT5 antibody was raised using a synthetic peptide corresponding to a region with amino acids ELSFKVWMCGGEIEIIPCSRVGHIFRNDNPYSFPKDRMKTVERNLVRVAE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GALNT5 Blocking Peptide, catalog no. 33R-2573, is also available for use as a blocking control in assays to test for specificity of this GALNT5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GALNT5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GALNT5

Antigène: GALNT5 (UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase 5 (GalNAc-T5) (GALNT5))

Autre désignation: GALNT5 (GALNT5 Produits)

Synonymes: anticorps GALNAC-T5, anticorps GALNACT5, anticorps GALNT5, anticorps 4832424J23, anticorps polypeptide N-acetylgalactosaminyltransferase 5, anticorps GALNT5, anticorps Galnt5

Sujet: GALNT5 can catalyze the initial reaction in O-linked oligosaccharide biosynthesis,the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor. GALNT5 has activity toward EA2 peptide substrate, but it has a weak activity toward Muc2 or Muc1b substrates.

Poids moléculaire: 106 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process