TIM3 anticorps (N-Term)
-
- Antigène Voir toutes TIM3 (TIM 3) Anticorps
- TIM3 (TIM 3) (Hepatitis A Virus Cellular Receptor 2 (TIM 3))
-
Épitope
- N-Term
-
Reactivité
- Hepatitis A Virus (HAV)
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TIM3 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- HAVCR2 antibody was raised against the N terminal of HAVCR2
- Purification
- Affinity purified
- Immunogène
- HAVCR2 antibody was raised using the N terminal of HAVCR2 corresponding to a region with amino acids MFSHLPFDCVLLLLLLLLTRSSEVEYRAEVGQNAYLPCFYTPAAPGNLVP
- Top Product
- Discover our top product TIM 3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
HAVCR2 Blocking Peptide, catalog no. 33R-6002, is also available for use as a blocking control in assays to test for specificity of this HAVCR2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HAVCR2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TIM3 (TIM 3) (Hepatitis A Virus Cellular Receptor 2 (TIM 3))
- Autre désignation
- HAVCR2 (TIM 3 Produits)
- Synonymes
- anticorps HAVCR2, anticorps MGC140131, anticorps HAVcr-2, anticorps KIM-3, anticorps TIM3, anticorps TIMD-3, anticorps TIMD3, anticorps Tim-3, anticorps TIM-3, anticorps Tim3, anticorps Timd3, anticorps tim3, anticorps hepatitis A virus cellular receptor 2, anticorps HAVCR2, anticorps Havcr2
- Classe de substances
- Virus
- Sujet
- HAVCR2 regulates macrophage activation. HAVCR2 inhibits T-helper type 1 lymphocyte (Th1)-mediated auto- and alloimmune responses and promotes immunological tolerance. HAVCR2 may be also involved in T-cell homing.
- Poids moléculaire
- 33 kDa (MW of target protein)
- Pathways
- Regulation of Lipid Metabolism by PPARalpha, Cancer Immune Checkpoints
-