BRI3BP anticorps (C-Term)

N° du produit ABIN635825

Détail du produit anti-BRI3BP anticorps

Antigène: BRI3BP (BRI3 Binding Protein (BRI3BP))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp BRI3BP est non-conjugé

Application: Western Blotting (WB)

Specificité: BRI3 BP antibody was raised against the C terminal of BRI3 P

Purification: Affinity purified

Immunogène: BRI3 BP antibody was raised using the C terminal of BRI3 P corresponding to a region with amino acids GFYWRSSPSGPSNPSNPSVEEKLEHLEKQVRLLNIRLNRVLESLDRSKDK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

BRI3BP Blocking Peptide, catalog no. 33R-3270, is also available for use as a blocking control in assays to test for specificity of this BRI3BP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BRI0 P antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur BRI3BP

Antigène: BRI3BP (BRI3 Binding Protein (BRI3BP))

Autre désignation: BRI3BP (BRI3BP Produits)

Synonymes: anticorps fa20c12, anticorps wu:fa20c12, anticorps kg19, anticorps bnas1, anticorps hccr-2, anticorps BNAS1, anticorps HCCR-1, anticorps HCCR-2, anticorps HCCRBP-1, anticorps KG19, anticorps 2410150I18Rik, anticorps AI841257, anticorps AW742481, anticorps bri3 binding protein, anticorps BRI3 binding protein pseudogene, anticorps BRI3 binding protein L homeolog, anticorps BRI3 binding protein, anticorps Bri3 binding protein, anticorps bri3bp, anticorps LOC452360, anticorps bri3bp.L, anticorps BRI3BP, anticorps Bri3bp

Sujet: BRI3BP is involved in the structural dynamics of the ER and affects mitochondrial viability.It is widely expressed in animal cell types, that seems to possess a pro-apoptotic property and can potentiate drug-induced apoptosis.

Poids moléculaire: 28 kDa (MW of target protein)