UGT1A4 anticorps (N-Term)

N° du produit ABIN635830

Détail du produit anti-UGT1A4 anticorps

Antigène: UGT1A4 (UDP Glucuronosyltransferase 1 Family, Polypeptide A4 (UGT1A4))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp UGT1A4 est non-conjugé

Application: Western Blotting (WB)

Specificité: UGT1 A4 antibody was raised against the N terminal of µgT1 4

Purification: Affinity purified

Immunogène: UGT1 A4 antibody was raised using the N terminal of µgT1 4 corresponding to a region with amino acids VVLTPEVNMHIKEEKFFTLTAYAVPWTQKEFDRVTLGYTQGFFETEHLLK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

UGT1A4 Blocking Peptide, catalog no. 33R-9886, is also available for use as a blocking control in assays to test for specificity of this µgT1A4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of µgT0 4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur UGT1A4

Antigène: UGT1A4 (UDP Glucuronosyltransferase 1 Family, Polypeptide A4 (UGT1A4))

Autre désignation: UGT1A4 (UGT1A4 Produits)

Synonymes: anticorps HUG-BR2, anticorps UDPGT, anticorps UDPGT 1-4, anticorps UGT-1D, anticorps UGT1-04, anticorps UGT1.4, anticorps UGT1D, anticorps UGT1, anticorps UGT1A4, anticorps UDP glucuronosyltransferase family 1 member A4, anticorps UDP-glucuronosyltransferase 1-4, anticorps UGT1A4, anticorps UGT1-4

Sujet: UGT1A4 is an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This enzyme has some glucuronidase activity towards bilirubin, although is is more active on amines, steroids, and sapogenins.

Poids moléculaire: 57 kDa (MW of target protein)

Pathways: Steroid Hormone Biosynthesis, Regulation of Lipid Metabolism by PPARalpha