SYVN1 anticorps (C-Term)

N° du produit ABIN635832

Détail du produit anti-SYVN1 anticorps

Antigène: SYVN1 (Synovial Apoptosis Inhibitor 1, Synoviolin (SYVN1))

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SYVN1 est non-conjugé

Application: Western Blotting (WB)

Specificité: SYVN1 antibody was raised against the C terminal of SYVN1

Purification: Affinity purified

Immunogène: SYVN1 antibody was raised using the C terminal of SYVN1 corresponding to a region with amino acids ARLQSLRNIHTLLDAAMLQINQYLTVLASLGPPRPATSVNSTEETATTVV

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SYVN1 Blocking Peptide, catalog no. 33R-1484, is also available for use as a blocking control in assays to test for specificity of this SYVN1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SYVN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SYVN1

Antigène: SYVN1 (Synovial Apoptosis Inhibitor 1, Synoviolin (SYVN1))

Autre désignation: SYVN1 (SYVN1 Produits)

Synonymes: anticorps DER3, anticorps HRD1, anticorps hrd1, anticorps 1200010C09Rik, anticorps AW211966, anticorps C85322, anticorps D530017H19Rik, anticorps Hrd1, anticorps RGD1310488, anticorps syvn1, anticorps syvn1-a, anticorps syvn1-b, anticorps wu:fk91f10, anticorps zgc:55735, anticorps zgc:77108, anticorps synoviolin 1, anticorps synovial apoptosis inhibitor 1, synoviolin, anticorps synoviolin 1 S homeolog, anticorps SYVN1, anticorps syvn1, anticorps Syvn1, anticorps syvn1.S

Sujet: SYVN1 is a protein involved in endoplasmic reticulum (ER)-associated degradation. The protein removes unfolded proteins, accumulated during ER stress, by retrograde transport to the cytosol from the ER. This protein also uses the ubiquitin-proteasome system for additional degradation of unfolded proteins.

Poids moléculaire: 67 kDa (MW of target protein)

Pathways: ER-Nucleus Signaling, Negative Regulation of intrinsic apoptotic Signaling