FZD7 anticorps

N° du produit ABIN635842

Détail du produit anti-FZD7 anticorps

Antigène: FZD7 (Frizzled Family Receptor 7 (FZD7))

Reactivité: Humain, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FZD7 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Affinity purified

Immunogène: FZD7 antibody was raised using a synthetic peptide corresponding to a region with amino acids PDFTVFMIKYLMTMIVGITTGFWIWSGKTLQSWRRFYHRLSHSSKGETAV

Information d'application

Indications d'application: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FZD7 Blocking Peptide, catalog no. 33R-7010, is also available for use as a blocking control in assays to test for specificity of this FZD7 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FZD7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FZD7

Antigène: FZD7 (Frizzled Family Receptor 7 (FZD7))

Autre désignation: FZD7 (FZD7 Produits)

Synonymes: anticorps FzE3, anticorps Fz-7, anticorps Xfz7, anticorps frizzled-7, anticorps frizzled7, anticorps frz-7, anticorps frz7, anticorps fz7, anticorps fzd7-a, anticorps fzd7-b, anticorps fze3, anticorps Fz7, anticorps cFz-7, anticorps fb38g02, anticorps fc44b09, anticorps fz13, anticorps fz7a, anticorps fz7b, anticorps wu:fb38g02, anticorps wu:fc44b09, anticorps zg13, anticorps frizzled class receptor 7, anticorps frizzled class receptor 7 L homeolog, anticorps frizzled class receptor 7b, anticorps FZD7, anticorps fzd7.L, anticorps fzd7, anticorps Fzd7, anticorps fzd7b

Sujet: FZD7 is 7-transmembrane domain protein that is receptor for Wnt signaling proteins. The FZD7 protein contains an N-terminal signal sequence, 10 cysteine residues typical of the cysteine-rich extracellular domain of Fz family members, 7 putative transmembrane domains, and an intracellular C-terminal tail with a PDZ domain-binding motif.

Poids moléculaire: 63 kDa (MW of target protein)

Pathways: Signalisation WNT, Stem Cell Maintenance