BACE1 anticorps (N-Term)
-
- Antigène Voir toutes BACE1 Anticorps
- BACE1 (Beta-secretase 1 (BACE1))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp BACE1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- BACE1 antibody was raised against the N terminal of BACE1
- Purification
- Affinity purified
- Immunogène
- BACE1 antibody was raised using the N terminal of BACE1 corresponding to a region with amino acids GQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSSTY
- Top Product
- Discover our top product BACE1 Anticorps primaire
-
anti-Beta-secretase 1 (BACE1) (AA 112-324) antibody
BACE1 Reactivité: Humain, Souris, Rat WB, ELISA, ICC, FACS Hôte: Souris Monoclonal 3C1C3 unconjugated
anti-Beta-secretase 1 (BACE1) (AA 22-501) antibodyBACE1 Reactivité: Humain WB, ELISA, IHC (p), PLA Hôte: Souris Monoclonal 2C1 unconjugated
anti-Beta-secretase 1 (BACE1) (N-Term) antibodyBACE1 Reactivité: Humain, Souris, Rat, Boeuf (Vache), Chien, Cobaye, Cheval, Lapin, Poisson zèbre (Danio rerio) WB, IHC, IF Hôte: Lapin Polyclonal unconjugated
anti-Beta-secretase 1 (BACE1) (AA 401-501) antibodyBACE1 Reactivité: Humain, Souris, Rat WB, ELISA, ICC, IHC (p), FACS, IF (cc), IF (p), IHC (fro) Hôte: Lapin Polyclonal unconjugated
anti-Beta-secretase 1 (BACE1) (AA 38-70), (N-Term) antibodyBACE1 Reactivité: Humain, Souris WB, IHC (p) Hôte: Lapin Polyclonal RB16874 unconjugated
anti-Beta-secretase 1 (BACE1) (AA 22-322) antibodyBACE1 Reactivité: Humain WB, IHC, IF Hôte: Lapin Polyclonal unconjugated
anti-Beta-secretase 1 (BACE1) (AA 46-155) antibodyBACE1 Reactivité: Humain ELISA, IHC, IF Hôte: Lapin Polyclonal unconjugated
anti-Beta-secretase 1 (BACE1) (C-Term) antibodyBACE1 Reactivité: Humain, Singe IHC, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-Beta-secretase 1 (BACE1) (AA 72-121) antibodyBACE1 Reactivité: Humain, Souris, Rat, Boeuf (Vache), Cobaye, Cheval, Lapin, Singe, Porc, Roussette (Chauve-souris), Hamster WB, IHC, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-Beta-secretase 1 (BACE1) (AA 170-428) antibodyBACE1 Reactivité: Humain WB, IHC, IP, ICC Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
BACE1 Blocking Peptide, catalog no. 33R-3496, is also available for use as a blocking control in assays to test for specificity of this BACE1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BACE1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- BACE1 (Beta-secretase 1 (BACE1))
- Autre désignation
- BACE1 (BACE1 Produits)
- Synonymes
- anticorps ASP2, anticorps BACE, anticorps HSPC104, anticorps C76936, anticorps Bace, anticorps MGC145931, anticorps BACE1, anticorps zgc:77409, anticorps beta-secretase 1, anticorps beta-site APP cleaving enzyme 1, anticorps beta-site APP-cleaving enzyme 1, anticorps BACE1, anticorps Bace1, anticorps bace1
- Sujet
- Cerebral deposition of amyloid beta peptide is an early and critical feature of Alzheimer's disease. Amyloid beta peptide is generated by proteolytic cleavage of amyloid precursor protein (APP) by two proteases, one of which is the protein. BACE1, a member of the peptidase A1 protein family, is a type I integral membrane glycoprotein and aspartic protease that is found mainly in the Golgi.
- Poids moléculaire
- 51 kDa (MW of target protein)
-
