ST6GALNAC4 anticorps (Middle Region)

N° du produit ABIN635850

Détail du produit anti-ST6GALNAC4 anticorps

Antigène: ST6GALNAC4 (ST6 (Alpha-N-Acetyl-Neuraminyl-2,3-beta-Galactosyl-1,3)-N-Acetylgalactosaminide alpha-2,6-Sialyltransferase 4 (ST6GALNAC4))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ST6GALNAC4 est non-conjugé

Application: Western Blotting (WB)

Specificité: ST6 GALNAC4 antibody was raised against the middle region of ST6 ALNAC4

Purification: Affinity purified

Immunogène: ST6 GALNAC4 antibody was raised using the middle region of ST6 ALNAC4 corresponding to a region with amino acids QLTRMYPGLQVYTFTERMMAYCDQIFQDETGKNRRQSGSFLSTGWFTMIL

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ST6GALNAC4 Blocking Peptide, catalog no. 33R-7650, is also available for use as a blocking control in assays to test for specificity of this ST6GALNAC4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ST0 ALNAC4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ST6GALNAC4

Antigène: ST6GALNAC4 (ST6 (Alpha-N-Acetyl-Neuraminyl-2,3-beta-Galactosyl-1,3)-N-Acetylgalactosaminide alpha-2,6-Sialyltransferase 4 (ST6GALNAC4))

Autre désignation: ST6GALNAC4 (ST6GALNAC4 Produits)

Synonymes: anticorps ST6GALNAC-IV, anticorps IV, anticorps SIAT3-C, anticorps SIAT3C, anticorps SIAT7-D, anticorps SIAT7D, anticorps ST6GALNACIV, anticorps ST6GalNAc, anticorps SIAT7B, anticorps ST6GALNAC2, anticorps st6GalNAc-IV, anticorps ST6GalNAcIV, anticorps Siat7d, anticorps siat7D, anticorps ST6 N-acetylgalactosaminide alpha-2,6-sialyltransferase 4, anticorps ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 4, anticorps ST6GALNAC4, anticorps St6galnac4

Sujet: ST6GALNAC4 is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. ST6GALNAC4 prefers glycoproteins rather than glycolipids as substrates and shows restricted substrate specificity, utilizing only the trisaccharide sequence Neu5Ac-alpha-2,3-Gal-beta-1,3-GalNAc. In addition, it is involved in the synthesis of ganglioside GD1A from GM1B. ST6GALNAC4 is normally found in the Golgi apparatus but can be proteolytically processed to a soluble form. It is a member of glycosyltransferase family 29.

Poids moléculaire: 34 kDa (MW of target protein)