CA4 anticorps (C-Term)
-
- Antigène Voir toutes CA4 Anticorps
- CA4 (Carbonic Anhydrase IV (CA4))
-
Épitope
- C-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CA4 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Carbonic Anhydrase IV antibody was raised against the C terminal of CA4
- Purification
- Affinity purified
- Immunogène
- Carbonic Anhydrase IV antibody was raised using the C terminal of CA4 corresponding to a region with amino acids AFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIKSGAPGRPLPWALPALLG
- Top Product
- Discover our top product CA4 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Carbonic Anhydrase IV Blocking Peptide, catalog no. 33R-1176, is also available for use as a blocking control in assays to test for specificity of this Carbonic Anhydrase IV antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CA4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CA4 (Carbonic Anhydrase IV (CA4))
- Autre désignation
- Carbonic Anhydrase IV (CA4 Produits)
- Synonymes
- anticorps CAIV, anticorps Car4, anticorps RP17, anticorps AW456718, anticorps Ca4, anticorps ca4, anticorps caiv, anticorps car4, anticorps rp17, anticorps CA4, anticorps zgc:171842, anticorps carbonic anhydrase 4, anticorps carbonic anhydrase 4 S homeolog, anticorps carbonic anhydrase IV a, anticorps CA4, anticorps Car4, anticorps ca4, anticorps ca4.S, anticorps Ca4, anticorps ca4a
- Sujet
- Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA4 is a glycosylphosphatidyl-inositol-anchored membrane isozyme expressed on the luminal surfaces of pulmonary (and certain other) capillaries and of proximal renal tubules. Its exact function is not known.
- Poids moléculaire
- 34 kDa (MW of target protein)
-