SLC22A15 anticorps (Middle Region)
-
- Antigène Voir toutes SLC22A15 Anticorps
- SLC22A15 (Solute Carrier Family 22, Member 15 (SLC22A15))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SLC22A15 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- SLC22 A15 antibody was raised against the middle region of SLC22 15
- Purification
- Affinity purified
- Immunogène
- SLC22 A15 antibody was raised using the middle region of SLC22 15 corresponding to a region with amino acids NQKWFGRKRTLSAFLCLGGLACLIVMFLPEKKDTGVFAVVNSHSLSLLGK
- Top Product
- Discover our top product SLC22A15 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLC22A15 Blocking Peptide, catalog no. 33R-6840, is also available for use as a blocking control in assays to test for specificity of this SLC22A15 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 15 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SLC22A15 (Solute Carrier Family 22, Member 15 (SLC22A15))
- Autre désignation
- SLC22A15 (SLC22A15 Produits)
- Synonymes
- anticorps FLIPT1, anticorps PRO34686, anticorps 2610034P21Rik, anticorps 4930477M19, anticorps A530052I06Rik, anticorps BB219042, anticorps solute carrier family 22 member 15, anticorps solute carrier family 22 (organic anion/cation transporter), member 15, anticorps solute carrier family 22, member 15, anticorps SLC22A15, anticorps Slc22a15
- Sujet
- Organic ion transporters, such as SLC22A15, transport various medically and physiologically important compounds, including pharmaceuticals, toxins, hormones, neurotransmitters, and cellular metabolites.
- Poids moléculaire
- 59 kDa (MW of target protein)
-