TEX264 anticorps (Middle Region)

N° du produit ABIN635856

Détail du produit anti-TEX264 anticorps

Antigène: TEX264 (Testis Expressed 264 (TEX264))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TEX264 est non-conjugé

Application: Western Blotting (WB)

Specificité: TEX264 antibody was raised against the middle region of TEX264

Purification: Affinity purified

Immunogène: TEX264 antibody was raised using the middle region of TEX264 corresponding to a region with amino acids GWDDGDTRSEHSYSESGASGSSFEELDLEGEGPLGESRLDPGTEPLGTTK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TEX264 Blocking Peptide, catalog no. 33R-3666, is also available for use as a blocking control in assays to test for specificity of this TEX264 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TEX264 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TEX264

Antigène: TEX264 (Testis Expressed 264 (TEX264))

Autre désignation: TEX264 (TEX264 Produits)

Synonymes: anticorps ZSIG11, anticorps TEG-264, anticorps testis expressed 264, anticorps testis expressed gene 264, anticorps TEX264, anticorps Tex264

Sujet: The specific function of TEX264 is not yet known.

Poids moléculaire: 34 kDa (MW of target protein)