SLITRK6 anticorps (N-Term)

N° du produit ABIN635857

Détail du produit anti-SLITRK6 anticorps

Antigène: SLITRK6 (SLIT and NTRK-Like Family, Member 6 (SLITRK6))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLITRK6 est non-conjugé

Application: Western Blotting (WB)

Specificité: SLITRK6 antibody was raised against the N terminal of SLITRK6

Purification: Affinity purified

Immunogène: SLITRK6 antibody was raised using the N terminal of SLITRK6 corresponding to a region with amino acids NFITVIEPSAFSKLNRLKVLILNDNAIESLPPNIFRFVPLTHLDLRGNQL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLITRK6 Blocking Peptide, catalog no. 33R-6684, is also available for use as a blocking control in assays to test for specificity of this SLITRK6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLITRK6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLITRK6

Antigène: SLITRK6 (SLIT and NTRK-Like Family, Member 6 (SLITRK6))

Autre désignation: SLITRK6 (SLITRK6 Produits)

Synonymes: anticorps 4832410J21Rik, anticorps Sltk6, anticorps SLIT and NTRK like family member 6, anticorps SLIT and NTRK-like family, member 6, anticorps SLITRK6, anticorps slitrk6, anticorps Slitrk6

Sujet: Members of the SLITRK family, such as SLITRK6, are integral membrane proteins with 2 N-terminal leucine-rich repeat (LRR) domains similar to those of SLIT proteins. Most SLITRKs, including SLITRK6, also have C-terminal regions that share homology with neurotrophin receptors. SLITRKs are expressed predominantly in neural tissues and have neurite-modulating activity.

Poids moléculaire: 95 kDa (MW of target protein)