SLITRK1 anticorps (N-Term)

N° du produit ABIN635858

Détail du produit anti-SLITRK1 anticorps

Antigène: SLITRK1 (SLIT and NTRK-Like Family, Member 1 (SLITRK1))

Épitope: N-Term

Reactivité: Rat, Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLITRK1 est non-conjugé

Application: Western Blotting (WB)

Specificité: SLITRK1 antibody was raised against the N terminal of SLITRK1

Purification: Affinity purified

Immunogène: SLITRK1 antibody was raised using the N terminal of SLITRK1 corresponding to a region with amino acids CDLLSLKEWLENIPKNALIGRVVCEAPTRLQGKDLNETTEQDLCPLKNRV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLITRK1 Blocking Peptide, catalog no. 33R-1668, is also available for use as a blocking control in assays to test for specificity of this SLITRK1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLITRK1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLITRK1

Antigène: SLITRK1 (SLIT and NTRK-Like Family, Member 1 (SLITRK1))

Autre désignation: SLITRK1 (SLITRK1 Produits)

Synonymes: anticorps DKFZp459G0529, anticorps LRRC12, anticorps TTM, anticorps 3200001I04Rik, anticorps SLIT and NTRK like family member 1, anticorps SLIT and NTRK-like family, member 1, anticorps SLITRK1, anticorps slitrk1, anticorps Slitrk1

Sujet: Members of the SLITRK family, such as SLITRK1, are integral membrane proteins with 2 N-terminal leucine-rich repeat (LRR) domains similar to those of SLIT proteins. Most SLITRKs, but not SLITRK1, also have C-terminal regions that share homology with neurotrophin receptors. SLITRKs are expressed predominantly in neural tissues and have neurite-modulating activity.

Poids moléculaire: 78 kDa (MW of target protein)