AADAC anticorps
-
- Antigène Voir toutes AADAC Anticorps
- AADAC (Arylacetamide Deacetylase (Esterase) (AADAC))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp AADAC est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- AADAC antibody was raised using a synthetic peptide corresponding to a region with amino acids AHLKTIQNLATFVELLGLHHFMDSFKVVGSFDEVPPTSDENVTVTETKFN
- Top Product
- Discover our top product AADAC Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
AADAC Blocking Peptide, catalog no. 33R-1251, is also available for use as a blocking control in assays to test for specificity of this AADAC antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AADAC antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- AADAC (Arylacetamide Deacetylase (Esterase) (AADAC))
- Autre désignation
- AADAC (AADAC Produits)
- Synonymes
- anticorps MGC89272, anticorps AADAC, anticorps CES5A1, anticorps DAC, anticorps Aada, anticorps 5033417E09Rik, anticorps AI265437, anticorps arylacetamide deacetylase, anticorps arylacetamide deacetylase S homeolog, anticorps Arylacetamide deacetylase, anticorps arylacetamide deacetylase (esterase), anticorps LOC100056411, anticorps aadac, anticorps AADAC, anticorps aadac.S, anticorps LOC100451808, anticorps ACD3, anticorps PTRG_10278, anticorps aaad, anticorps Aadac
- Sujet
- Microsomal arylacetamide deacetylase competes against the activity of cytosolic arylamine N-acetyltransferase, which catalyzes one of the initial biotransformation pathways for arylamine and heterocyclic amine carcinogens.Microsomal arylacetamide deacetylase competes against the activity of cytosolic arylamine N-acetyltransferase, which catalyzes one of the initial biotransformation pathways for arylamine and heterocyclic amine carcinogens.
- Poids moléculaire
- 46 kDa (MW of target protein)
-