UGT1A1 anticorps (N-Term)
-
- Antigène Voir toutes UGT1A1 Anticorps
- UGT1A1 (UDP Glucuronosyltransferase 1 Family, Polypeptide A1 (UGT1A1))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp UGT1A1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- UGT1 A1 antibody was raised against the N terminal of µgT1 1
- Purification
- Affinity purified
- Immunogène
- UGT1 A1 antibody was raised using the N terminal of µgT1 1 corresponding to a region with amino acids DGSHWLSMLGAIQQLQQRGHEIVVLAPDASLYIRDGAFYTLKTYPVPFQR
- Top Product
- Discover our top product UGT1A1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
UGT1A1 Blocking Peptide, catalog no. 33R-1966, is also available for use as a blocking control in assays to test for specificity of this µgT1A1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of µgT0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- UGT1A1 (UDP Glucuronosyltransferase 1 Family, Polypeptide A1 (UGT1A1))
- Autre désignation
- UGT1A1 (UGT1A1 Produits)
- Synonymes
- anticorps BILIQTL1, anticorps GNT1, anticorps HUG-BR1, anticorps UDPGT, anticorps UDPGT 1-1, anticorps UGT1, anticorps UGT1A, anticorps Gnt1, anticorps UGT1A01, anticorps Udpgt-1a, anticorps UgtBr1, anticorps Udpgt, anticorps Ugt1, anticorps zgc:123097, anticorps UDP glucuronosyltransferase family 1 member A1, anticorps UDP glucuronosyltransferase 1 family, polypeptide A1, anticorps UDP-glucuronosyltransferase 1-1, anticorps UDP-glucuronosyltransferase, anticorps UDP-glucuronosyltransferase 1-6, anticorps UDP glucuronosyltransferase 1 family polypeptide a1, anticorps UGT1A1, anticorps Ugt1a1, anticorps LOC100065342, anticorps LOC100125517, anticorps LOC100229734, anticorps LOC100405984, anticorps LOC100511479, anticorps ugt1a1
- Sujet
- UGT1A1 is a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. The preferred substrate of this enzyme is bilirubin, although it also has moderate activity with simple phenols, flavones, and C18 steroids.
- Poids moléculaire
- 57 kDa (MW of target protein)
- Pathways
- Steroid Hormone Biosynthesis, Regulation of Lipid Metabolism by PPARalpha
-