Growth Hormone Receptor anticorps (N-Term)
-
- Antigène Voir toutes Growth Hormone Receptor (GHR) Anticorps
- Growth Hormone Receptor (GHR)
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Growth Hormone Receptor est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- GHR antibody was raised against the N terminal of GHR
- Purification
- Affinity purified
- Immunogène
- GHR antibody was raised using the N terminal of GHR corresponding to a region with amino acids LQSVNPGLKTNSSKEPKFTKCRSPERETFSCHWTDEVHHGTKNLGPIQLF
- Top Product
- Discover our top product GHR Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
GHR Blocking Peptide, catalog no. 33R-5341, is also available for use as a blocking control in assays to test for specificity of this GHR antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GHR antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Growth Hormone Receptor (GHR)
- Autre désignation
- GHR (GHR Produits)
- Synonymes
- anticorps GHBP, anticorps AA986417, anticorps GHR/BP, anticorps GHR, anticorps ghr, anticorps ghr.a, anticorps zgc:162141, anticorps growth hormone receptor, anticorps growth hormone receptor L homeolog, anticorps growth hormone receptor a, anticorps GHR, anticorps Ghr, anticorps ghr.L, anticorps ghr, anticorps ghra
- Sujet
- GHR is a protein that is a transmembrane receptor for growth hormone. Binding of growth hormone to the receptor leads to receptor dimerization and the activation of an intra- and intercellular signal transduction pathway leading to growth. A common alternate allele of this gene, called GHRd3, lacks exon three and has been well-characterized. Mutations in this gene have been associated with Laron syndrome, also known as the growth hormone insensitivity syndrome (GHIS), a disorder characterized by short stature.
- Poids moléculaire
- 70 kDa (MW of target protein)
- Pathways
- Signalisation NF-kappaB, Signalistation JAK/STAT, Response to Growth Hormone Stimulus
-