GPAA1 anticorps
-
- Antigène Voir toutes GPAA1 Anticorps
- GPAA1 (GPI Anchor Attachment Protein 1 (GPAA1))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp GPAA1 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Affinity purified
- Immunogène
- GPAA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LGSLFLWRELQEAPLSLAEGWQLFLAALAQGVLEHHTYGALLFPLLSLGL
- Top Product
- Discover our top product GPAA1 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
GPAA1 Blocking Peptide, catalog no. 33R-4996, is also available for use as a blocking control in assays to test for specificity of this GPAA1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPAA1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- GPAA1 (GPI Anchor Attachment Protein 1 (GPAA1))
- Autre désignation
- GPAA1 (GPAA1 Produits)
- Synonymes
- anticorps GAA1, anticorps hGAA1, anticorps C80044, anticorps mGAA1, anticorps glycosylphosphatidylinositol anchor attachment 1, anticorps GPI anchor attachment protein 1, anticorps GPAA1, anticorps Gpaa1
- Sujet
- Posttranslational glycosylphosphatidylinositol (GPI) anchor attachment serves as a general mechanism for linking proteins to the cell surface membrane. GPAA1 presumably functions in GPI anchoring at the GPI transfer step. The anchor attachment protein 1 contains an N-terminal signal sequence, 1 cAMP- and cGMP-dependent protein kinase phosphorylation site, 1 leucine zipper pattern, 2 potential N-glycosylation sites, and 8 putative transmembrane domains.
- Poids moléculaire
- 67 kDa (MW of target protein)
- Pathways
- Inositol Metabolic Process, Maintenance of Protein Location, SARS-CoV-2 Protein Interactome
-