LMAN1 anticorps (N-Term)

N° du produit ABIN635868

Détail du produit anti-LMAN1 anticorps

Antigène: LMAN1 (Lectin, Mannose-Binding, 1 (LMAN1))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LMAN1 est non-conjugé

Application: Western Blotting (WB)

Specificité: LMAN1 antibody was raised against the N terminal of LMAN1

Purification: Affinity purified

Immunogène: LMAN1 antibody was raised using the N terminal of LMAN1 corresponding to a region with amino acids DPAVALPHRRFEYKYSFKGPHLVQSDGTVPFWAHAGNAIPSSDQIRVAPS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LMAN1 Blocking Peptide, catalog no. 33R-2095, is also available for use as a blocking control in assays to test for specificity of this LMAN1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LMAN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LMAN1

Antigène: LMAN1 (Lectin, Mannose-Binding, 1 (LMAN1))

Autre désignation: LMAN1 (LMAN1 Produits)

Synonymes: anticorps ERGIC-53, anticorps ERGIC53, anticorps F5F8D, anticorps FMFD1, anticorps MCFD1, anticorps MR60, anticorps gp58, anticorps 2610020P13Rik, anticorps AI326273, anticorps AU043785, anticorps C730041J05, anticorps P58, anticorps p58, anticorps LMAN1, anticorps cpx-iii, anticorps cpxiii, anticorps lman1, anticorps wu:fc54c09, anticorps wu:fi36e01, anticorps Xp58, anticorps lman1-a, anticorps lectin, mannose binding 1, anticorps lectin, mannose-binding, 1, anticorps complexin 3, anticorps lectin, mannose binding 1 S homeolog, anticorps LMAN1, anticorps Lman1, anticorps cplx3, anticorps lman1, anticorps lman1.S

Sujet: LMAN1 is a type I integral membrane protein localized in the intermediate region between the endoplasmic reticulum and the Golgi, presumably recycling between the two compartments. The protein is a mannose-specific lectin and is a member of a novel family of plant lectin homologs in the secretory pathway of animal cells. Mutations in its gene are associated with a coagulation defect. Using positional cloning, its gene was identified as the disease gene leading to combined factor V-factor VIII deficiency, a rare, autosomal recessive disorder in which both coagulation factors V and VIII are diminished.

Poids moléculaire: 54 kDa (MW of target protein)