MGAT2 anticorps
-
- Antigène Voir toutes MGAT2 Anticorps
- MGAT2 (Mannosyl (Alpha-1,6-)-Glycoprotein beta-1,2-N-Acetylglucosaminyltransferase (MGAT2))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp MGAT2 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- MGAT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids YAGLILFLEEDHYLAPDFYHVFKKMWKLKQQECPECDVLSLGTYSASRSF
- Top Product
- Discover our top product MGAT2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
MGAT2 Blocking Peptide, catalog no. 33R-10048, is also available for use as a blocking control in assays to test for specificity of this MGAT2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MGAT2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- MGAT2 (Mannosyl (Alpha-1,6-)-Glycoprotein beta-1,2-N-Acetylglucosaminyltransferase (MGAT2))
- Autre désignation
- MGAT2 (MGAT2 Produits)
- Synonymes
- anticorps CDG2A, anticorps CDGS2, anticorps GLCNACTII, anticorps GNT-II, anticorps GNT2, anticorps CG7921, anticorps Dmel\\CG7921, anticorps GlcNAc-TII, anticorps GlcNAcT2, anticorps dMGAT2, anticorps MGC89475, anticorps Gnt2, anticorps AA407964, anticorps CH73-301C19.1, anticorps zgc:162268, anticorps mannosyl (alpha-1,6-)-glycoprotein beta-1,2-N-acetylglucosaminyltransferase, anticorps CG7921 gene product from transcript CG7921-RB, anticorps mannosyl (alpha-1,6-)-glycoprotein beta-1,2-N-acetylglucosaminyltransferase L homeolog, anticorps mannoside acetylglucosaminyltransferase 2, anticorps MGAT2, anticorps Mgat2, anticorps mgat2.L, anticorps mgat2
- Sujet
- MGAT2 is a Golgi enzyme catalyzing an essential step in the conversion of oligomannose to complex N-glycans. The enzyme has the typical glycosyltransferase domains: a short N-terminal cytoplasmic domain, a hydrophobic non-cleavable signal-anchor domain, and a C-terminal catalytic domain. Mutations in its gene may lead to carbohydrate-deficient glycoprotein syndrome, type II. The product of this gene is a Golgi enzyme catalyzing an essential step in the conversion of oligomannose to complex N-glycans.
- Poids moléculaire
- 51 kDa (MW of target protein)
-