AOC2 anticorps

N° du produit ABIN635871

Détail du produit anti-AOC2 anticorps

Antigène: AOC2 (Amine Oxidase, Copper Containing 2 (Retina-Specific) (AOC2))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp AOC2 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: AOC2 antibody (retina specific) was raised using a synthetic peptide corresponding to a region with amino acids QATMVDIHILVGKGAVQLLPGAVCVFEEAQGLPLRRHHNYLQNHFYGGLA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

AOC2 Blocking Peptide (retina specific), catalog no. 33R-7481, is also available for use as a blocking control in assays to test for specificity of this AOC2 antibody (retina specific)

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AOC2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur AOC2

Antigène: AOC2 (Amine Oxidase, Copper Containing 2 (Retina-Specific) (AOC2))

Autre désignation: AOC2 (AOC2 Produits)

Synonymes: anticorps DAO2, anticorps RAO, anticorps AOC2, anticorps AOC3, anticorps aoc3, anticorps wu:fa94a08, anticorps wu:fe14c05, anticorps zgc:113006, anticorps amine oxidase, copper containing 2, anticorps amine oxidase, copper containing 2 (retina-specific), anticorps membrane primary amine oxidase-like, anticorps retina-specific copper amine oxidase, anticorps AOC2, anticorps Aoc2, anticorps LOC100353051, anticorps aoc2

Sujet: Copper amine oxidases catalyze the oxidative conversion of amines to aldehydes and ammonia in the presence of copper and quinone cofactor. The protein contains several conserved motifs including the active site of amine oxidases and the histidine residues that likely bind copper. It may be a critical modulator of signal transmission in retina, possibly by degrading the biogenic amines dopamine, histamine, and putrescine.

Poids moléculaire: 84 kDa (MW of target protein)