LMF1 anticorps (N-Term)

N° du produit ABIN635873

Détail du produit anti-LMF1 anticorps

Antigène: LMF1 (Lipase Maturation Factor 1 (LMF1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LMF1 est non-conjugé

Application: Western Blotting (WB)

Specificité: LMF1 antibody was raised against the N terminal of LMF1

Purification: Affinity purified

Immunogène: LMF1 antibody was raised using the N terminal of LMF1 corresponding to a region with amino acids MRPDSPTMAAPAESLRRRKTGYSDPEPESPPAPGRGPAGSPAHLHTGTFW

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LMF1 Blocking Peptide, catalog no. 33R-6372, is also available for use as a blocking control in assays to test for specificity of this LMF1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LMF1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LMF1

Antigène: LMF1 (Lipase Maturation Factor 1 (LMF1))

Autre désignation: LMF1 (LMF1 Produits)

Synonymes: anticorps C16orf26, anticorps HMFN1876, anticorps JFP11, anticorps TMEM112, anticorps TMEM112A, anticorps 2400010G15Rik, anticorps AW822050, anticorps Tmem112, anticorps cld, anticorps RGD1310180, anticorps lipase maturation factor 1, anticorps LMF1, anticorps lmf1, anticorps LOC100594835, anticorps Lmf1

Sujet: The protein encoded by this gene resides in the endoplasmic reticulum, and is involved in the maturation and transport of lipoprotein lipase through the secretory pathway. Mutations in this gene are associated with combined lipase deficiency.

Poids moléculaire: 65 kDa (MW of target protein)