IGLL1 anticorps (N-Term)
-
- Antigène Voir toutes IGLL1 Anticorps
- IGLL1 (Immunoglobulin lambda-Like Polypeptide 1 (IGLL1))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp IGLL1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PIGO antibody was raised against the N terminal of PIGO
- Purification
- Affinity purified
- Immunogène
- PIGO antibody was raised using the N terminal of PIGO corresponding to a region with amino acids LIDALRFDFAQPQHSHVPREPPVSLPFLGKLSSLQRILEIQPHHARLYRS
- Top Product
- Discover our top product IGLL1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PIGO Blocking Peptide, catalog no. 33R-5039, is also available for use as a blocking control in assays to test for specificity of this PIGO antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIGO antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- IGLL1 (Immunoglobulin lambda-Like Polypeptide 1 (IGLL1))
- Autre désignation
- IGO (IGLL1 Produits)
- Synonymes
- anticorps 14.1, anticorps AGM2, anticorps CD179b, anticorps IGL1, anticorps IGL5, anticorps IGLJ14.1, anticorps IGLL, anticorps IGO, anticorps IGVPB, anticorps VPREB2, anticorps IGLV, anticorps IGLL1, anticorps MGC151892, anticorps Igll1, anticorps BB139905, anticorps Igl-5, anticorps Igll, anticorps Lambda5, anticorps immunoglobulin lambda like polypeptide 1, anticorps immunoglobulin lambda-like polypeptide 1, anticorps IGLL1, anticorps Igll1
- Sujet
- PIGO is a protein that is involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is a glycolipid which contains three mannose molecules in its core backbone. The GPI-anchor is found on many blood cells and serves to anchor proteins to the cell surface. PIGO is involved in the transfer of ethanolaminephosphate (EtNP) to the third mannose in GPI.
- Poids moléculaire
- 74 kDa (MW of target protein)
- Pathways
- Regulation of Cell Size
-