FZD6 anticorps

N° du produit ABIN635881

Détail du produit anti-FZD6 anticorps

Antigène: FZD6 (Frizzled Family Receptor 6 (FZD6))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FZD6 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: FZD6 antibody was raised using a synthetic peptide corresponding to a region with amino acids HKKKHYKPSSHKLKVISKSMGTSTGATANHGTSAVAITSHDYLGQETLTE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FZD6 Blocking Peptide, catalog no. 33R-3764, is also available for use as a blocking control in assays to test for specificity of this FZD6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FZD6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FZD6

Antigène: FZD6 (Frizzled Family Receptor 6 (FZD6))

Autre désignation: FZD6 (FZD6 Produits)

Synonymes: anticorps zgc:65879, anticorps zgc:77440, anticorps fz6, anticorps frz6, anticorps Xfrz6, anticorps frizzled6, anticorps frizzled-6, anticorps FZ-6, anticorps FZ6, anticorps HFZ6, anticorps NDNC10, anticorps Frizzled-6, anticorps Fz6, anticorps frizzled class receptor 6, anticorps frizzled class receptor 6 S homeolog, anticorps fzd6, anticorps fzd6.S, anticorps FZD6, anticorps Fzd6

Sujet: This gene represents a member of the 'frizzled' gene family, which encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins.

Poids moléculaire: 79 kDa (MW of target protein)

Pathways: Signalisation WNT, Tube Formation