LMAN2 anticorps (C-Term)
-
- Antigène Voir toutes LMAN2 Anticorps
- LMAN2 (Lectin, Mannose-Binding 2 (LMAN2))
-
Épitope
- C-Term
-
Reactivité
- Humain, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp LMAN2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- LMAN2 antibody was raised against the C terminal of LMAN2
- Purification
- Affinity purified
- Immunogène
- LMAN2 antibody was raised using the C terminal of LMAN2 corresponding to a region with amino acids LMVEHTPDEESIDWTKIEPSVNFLKSPKDNVDDPTGNFRSGPLTGWRVFL
- Top Product
- Discover our top product LMAN2 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
LMAN2 Blocking Peptide, catalog no. 33R-5215, is also available for use as a blocking control in assays to test for specificity of this LMAN2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LMAN2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- LMAN2 (Lectin, Mannose-Binding 2 (LMAN2))
- Autre désignation
- LMAN2 (LMAN2 Produits)
- Synonymes
- anticorps Lman2, anticorps wu:fb16f04, anticorps zgc:158761, anticorps C5orf8, anticorps GP36B, anticorps VIP36, anticorps 1110003H06Rik, anticorps 1300009F09Rik, anticorps AA408240, anticorps AL023023, anticorps AU040819, anticorps Vip36, anticorps lectin, mannose binding 2, anticorps lectin, mannose-binding 2, anticorps LMAN2, anticorps lman2, anticorps Lman2
- Sujet
- LMAN2 plays a role as an intracellular lectin in the early secretory pathway. It interacts with N-acetyl-D-galactosamine and high-mannose type glycans and may also bind to O-linked glycans. It is involved in the transport and sorting of glycoproteins carrying high mannose-type glycans.
- Poids moléculaire
- 36 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interactome
-