LMAN2 anticorps (C-Term)

N° du produit ABIN635888

Détail du produit anti-LMAN2 anticorps

Antigène: LMAN2 (Lectin, Mannose-Binding 2 (LMAN2))

Épitope: C-Term

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LMAN2 est non-conjugé

Application: Western Blotting (WB)

Specificité: LMAN2 antibody was raised against the C terminal of LMAN2

Purification: Affinity purified

Immunogène: LMAN2 antibody was raised using the C terminal of LMAN2 corresponding to a region with amino acids LMVEHTPDEESIDWTKIEPSVNFLKSPKDNVDDPTGNFRSGPLTGWRVFL

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LMAN2 Blocking Peptide, catalog no. 33R-5215, is also available for use as a blocking control in assays to test for specificity of this LMAN2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LMAN2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LMAN2

Antigène: LMAN2 (Lectin, Mannose-Binding 2 (LMAN2))

Autre désignation: LMAN2 (LMAN2 Produits)

Synonymes: anticorps Lman2, anticorps wu:fb16f04, anticorps zgc:158761, anticorps C5orf8, anticorps GP36B, anticorps VIP36, anticorps 1110003H06Rik, anticorps 1300009F09Rik, anticorps AA408240, anticorps AL023023, anticorps AU040819, anticorps Vip36, anticorps lectin, mannose binding 2, anticorps lectin, mannose-binding 2, anticorps LMAN2, anticorps lman2, anticorps Lman2

Sujet: LMAN2 plays a role as an intracellular lectin in the early secretory pathway. It interacts with N-acetyl-D-galactosamine and high-mannose type glycans and may also bind to O-linked glycans. It is involved in the transport and sorting of glycoproteins carrying high mannose-type glycans.

Poids moléculaire: 36 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome