AMIGO3 anticorps (N-Term)
-
- Antigène Voir toutes AMIGO3 Anticorps
- AMIGO3 (Adhesion Molecule with Ig-Like Domain 3 (AMIGO3))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp AMIGO3 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- AMIGO3 antibody was raised against the N terminal of AMIGO3
- Purification
- Affinity purified
- Immunogène
- AMIGO3 antibody was raised using the N terminal of AMIGO3 corresponding to a region with amino acids MTWLVLLGTLLCMLRVGLGTPDSEGFPPRALHNCPYKCICAADLLSCTGL
- Top Product
- Discover our top product AMIGO3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
AMIGO3 Blocking Peptide, catalog no. 33R-6574, is also available for use as a blocking control in assays to test for specificity of this AMIGO3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AMIGO3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- AMIGO3 (Adhesion Molecule with Ig-Like Domain 3 (AMIGO3))
- Autre désignation
- AMIGO3 (AMIGO3 Produits)
- Synonymes
- anticorps E430002N15Rik, anticorps ali3, anticorps mKIAA1851, anticorps AMIGO-3, anticorps adhesion molecule with Ig-like domain 3, anticorps adhesion molecule with Ig like domain 3, anticorps amigo3, anticorps Amigo3, anticorps AMIGO3
- Sujet
- AMIGO3 may mediate heterophilic cell-cell interaction. AMIGO3 may contribute to signal transduction through its intracellular domain.
- Poids moléculaire
- 55 kDa (MW of target protein)
-