NDST3 anticorps

N° du produit ABIN635893

Détail du produit anti-NDST3 anticorps

Antigène: NDST3 (N-Deacetylase/N-Sulfotransferase (Heparan Glucosaminyl) 3 (NDST3))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NDST3 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: NDST3 antibody was raised using a synthetic peptide corresponding to a region with amino acids PGTDWTVFQINHSAYQPVIFAKVKTPENLSPSISKGAFYATIIHDLGLHD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NDST3 Blocking Peptide, catalog no. 33R-7135, is also available for use as a blocking control in assays to test for specificity of this NDST3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NDST3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NDST3

Antigène: NDST3 (N-Deacetylase/N-Sulfotransferase (Heparan Glucosaminyl) 3 (NDST3))

Autre désignation: NDST3 (NDST3 Produits)

Synonymes: anticorps NDST3, anticorps HSST3, anticorps 4921531K01Rik, anticorps 4930511P15Rik, anticorps N-deacetylase and N-sulfotransferase 3, anticorps N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 3, anticorps NDST3, anticorps ndst3, anticorps LOC100484094, anticorps LOC100539813, anticorps Ndst3

Sujet: NDST3 is a member of the heparan sulfate/heparin GlcNAc N-deacetylase/ N-sulfotransferase family. NDST3 is a type II transmembrane protein that resides in the Golgi apparatus. This monomeric bifunctional enzyme catalyzes the N-deacetylation and N-sulfation of N-acetylglucosamine residues in heparan sulfate and heparin, which are the initial chemical modifications required for the biosynthesis of the functional oligosaccharide sequences that define the specific ligand binding activities of heparan sulfate and heparin.

Poids moléculaire: 101 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process