SPINT2 anticorps (Middle Region)
-
- Antigène Voir toutes SPINT2 Anticorps
- SPINT2 (serine Peptidase Inhibitor, Kunitz Type, 2 (SPINT2))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SPINT2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- SPINT2 antibody was raised against the middle region of SPINT2
- Purification
- Affinity purified
- Immunogène
- SPINT2 antibody was raised using the middle region of SPINT2 corresponding to a region with amino acids MLRCFRQQENPPLPLGSKVVVLAGLFVMVLILFLGASMVYLIRVARRNQE
- Top Product
- Discover our top product SPINT2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SPINT2 Blocking Peptide, catalog no. 33R-6208, is also available for use as a blocking control in assays to test for specificity of this SPINT2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPINT2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SPINT2 (serine Peptidase Inhibitor, Kunitz Type, 2 (SPINT2))
- Autre désignation
- SPINT2 (SPINT2 Produits)
- Synonymes
- anticorps HAI-2, anticorps Pb, anticorps DIAR3, anticorps HAI2, anticorps Kop, anticorps PB, anticorps AL024025, anticorps C76321, anticorps serine peptidase inhibitor, Kunitz type, 2, anticorps serine peptidase inhibitor, Kunitz type 2, anticorps serine protease inhibitor, Kunitz type 2, anticorps Spint2, anticorps SPINT2
- Sujet
- HAI-2 (SPINT2) is a candidate tumour suppressor gene that is frequently hypermethylated and underexpressed in human HCCs, and the kDa-1 domain of HAI-2 is the key region responsible for its anti-invasive function. It is also implicated in human cervical cancer.
- Poids moléculaire
- 28 kDa (MW of target protein)
-