EMID1 anticorps (C-Term)
-
- Antigène Tous les produits EMID1
- EMID1 (EMI Domain Containing 1 (EMID1))
-
Épitope
- C-Term
-
Reactivité
- Rat, Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp EMID1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- EMID1 antibody was raised against the C terminal of EMID1
- Purification
- Affinity purified
- Immunogène
- EMID1 antibody was raised using the C terminal of EMID1 corresponding to a region with amino acids TMIGLYEPELGSGAGPAGTGTPSLLRGKRGGHATNYRIVAPRSRDERG
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
EMID1 Blocking Peptide, catalog no. 33R-9201, is also available for use as a blocking control in assays to test for specificity of this EMID1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EMID1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- EMID1 (EMI Domain Containing 1 (EMID1))
- Autre désignation
- EMID1 (EMID1 Produits)
- Sujet
- EMID1 contains 1 collagen-like domain and 1 EMI domain. The exact function of EMID1 remains unknown.
- Poids moléculaire
- 45 kDa (MW of target protein)
-