RMDN3 anticorps (Middle Region)
-
- Antigène Voir toutes RMDN3 (FAM82A2) Anticorps
- RMDN3 (FAM82A2) (Family with Sequence Similarity 82, Member A2 (FAM82A2))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RMDN3 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- FAM82 C antibody was raised against the middle region of Fam82
- Purification
- Affinity purified
- Immunogène
- FAM82 C antibody was raised using the middle region of Fam82 corresponding to a region with amino acids LSATVEDALQSFLKAEELQPGFSKAGRVYISKCYRELGKNSEARWWMKLA
- Top Product
- Discover our top product FAM82A2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
FAM82C Blocking Peptide, catalog no. 33R-5411, is also available for use as a blocking control in assays to test for specificity of this FAM82C antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM80 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RMDN3 (FAM82A2) (Family with Sequence Similarity 82, Member A2 (FAM82A2))
- Autre désignation
- FAM82C (FAM82A2 Produits)
- Synonymes
- anticorps FAM82A2, anticorps FAM82C, anticorps RMD-3, anticorps RMD3, anticorps ptpip51, anticorps Fam82a2, anticorps Fam82c, anticorps Ptpip51, anticorps RGD1308697, anticorps Rmd-3, anticorps 1200015F23Rik, anticorps AI131757, anticorps Rmd3, anticorps fam82a2, anticorps fam82c, anticorps regulator of microtubule dynamics 3, anticorps regulator of microtubule dynamics 3 L homeolog, anticorps RMDN3, anticorps Rmdn3, anticorps rmdn3.L
- Sujet
- FAM82C may participate in differentiation and apoptosis of keratinocytes. Overexpression of FAM82C protein induces apoptosis.
- Poids moléculaire
- 52 kDa (MW of target protein)
-