C2CD2L anticorps (C-Term)

N° du produit ABIN635898

Détail du produit anti-C2CD2L anticorps

Antigène: C2CD2L (C2CD2-Like (C2CD2L))

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C2CD2L est non-conjugé

Application: Western Blotting (WB)

Specificité: TMEM24 antibody was raised against the C terminal Of Tmem24

Purification: Affinity purified

Immunogène: TMEM24 antibody was raised using the C terminal Of Tmem24 corresponding to a region with amino acids AGLSQSHDDLSNATATPSVRKKAGSFSRRLIKRFSFKSKPKANGNPSPQL

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMEM24 Blocking Peptide, catalog no. 33R-1209, is also available for use as a blocking control in assays to test for specificity of this TMEM24 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM24 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C2CD2L

Antigène: C2CD2L (C2CD2-Like (C2CD2L))

Autre désignation: TMEM24 (C2CD2L Produits)

Synonymes: anticorps TMEM24, anticorps 1300006O23Rik, anticorps Tmem24, anticorps tmem24, anticorps zgc:153961, anticorps C2CD2 like, anticorps C2 calcium-dependent domain containing 2-like, anticorps C2CD2-like, anticorps c2cd2-like, anticorps C2CD2L, anticorps C2cd2l, anticorps c2cd2l

Sujet: GADD45B is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The genes in this group respond to environmental stresses by mediating activation of the p38/JNK pathway. This activation is mediated via their proteins binding and activating MTK1/MEKK4 kinase, which is an upstream activator of both p38 and JNK MAPKs. The function of these genes or their protein products is involved in the regulation of growth and apoptosis. These genes are regulated by different mechanisms, but they are often coordinately expressed and can function cooperatively in inhibiting cell growth.

Poids moléculaire: 76 kDa (MW of target protein)