PQLC1 anticorps (Middle Region)
-
- Antigène Voir toutes PQLC1 Anticorps
- PQLC1 (PQ Loop Repeat Containing 1 (PQLC1))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PQLC1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PQLC1 antibody was raised against the middle region of PQLC1
- Purification
- Affinity purified
- Immunogène
- PQLC1 antibody was raised using the middle region of PQLC1 corresponding to a region with amino acids TYLSIDSALFVETLGFLAVLTEAMLGVPQLYRNHRHQSTEGMSIKMVLMW
- Top Product
- Discover our top product PQLC1 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PQLC1 Blocking Peptide, catalog no. 33R-9395, is also available for use as a blocking control in assays to test for specificity of this PQLC1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PQLC1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PQLC1 (PQ Loop Repeat Containing 1 (PQLC1))
- Autre désignation
- PQLC1 (PQLC1 Produits)
- Synonymes
- anticorps 2310009N05Rik, anticorps 4933425L21Rik, anticorps 5730564E11Rik, anticorps C78974, anticorps pqlc1, anticorps PQ loop repeat containing 1, anticorps PQ loop repeat containing 1, gene 1 L homeolog, anticorps PQLC1, anticorps Pqlc1, anticorps pqlc1.1.L
- Sujet
- PQLC1 is a multi-pass membrane protein. It contains 2 PQ-loop domains. The exact function of PQLC1 remains unknown.
- Poids moléculaire
- 30 kDa (MW of target protein)
-