GPR27 anticorps (Middle Region)
-
- Antigène Voir toutes GPR27 Anticorps
- GPR27 (G Protein-Coupled Receptor 27 (GPR27))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Rat, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp GPR27 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- GPR27 antibody was raised against the middle region of GPR27
- Purification
- Affinity purified
- Immunogène
- GPR27 antibody was raised using the middle region of GPR27 corresponding to a region with amino acids AVTLLFLLLWGPYVVASYLRVLVRPGAVPQAYLTASVWLTFAQAGINPVV
- Top Product
- Discover our top product GPR27 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
GPR27 Blocking Peptide, catalog no. 33R-1617, is also available for use as a blocking control in assays to test for specificity of this GPR27 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPR27 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- GPR27 (G Protein-Coupled Receptor 27 (GPR27))
- Autre désignation
- GPR27 (GPR27 Produits)
- Synonymes
- anticorps SREB1, anticorps Sreb1, anticorps G protein-coupled receptor 27, anticorps gpr27, anticorps GPR27, anticorps Gpr27
- Sujet
- GPR27 belongs to the G-protein coupled receptor 1 family. GPR27 is an orphan receptor. It is a possible candidate for amine-like G-protein coupled receptor.
- Poids moléculaire
- 40 kDa (MW of target protein)
-