RNF43 anticorps (Middle Region)
-
- Antigène Voir toutes RNF43 Anticorps
- RNF43 (Ring Finger Protein 43 (RNF43))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RNF43 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- RNF43 antibody was raised against the middle region of RNF43
- Purification
- Affinity purified
- Immunogène
- RNF43 antibody was raised using the middle region of RNF43 corresponding to a region with amino acids DFDPLVYCSPKGDPQRVDMQPSVTSRPRSLDSVVPTGETQVSSHVHYHRH
- Top Product
- Discover our top product RNF43 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RNF43 Blocking Peptide, catalog no. 33R-1926, is also available for use as a blocking control in assays to test for specificity of this RNF43 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF43 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RNF43 (Ring Finger Protein 43 (RNF43))
- Autre désignation
- RNF43 (RNF43 Produits)
- Synonymes
- anticorps RNF124, anticorps URCC, anticorps 4732452J19Rik, anticorps RGD1305204, anticorps ring finger protein 43, anticorps RNF43, anticorps Rnf43
- Sujet
- RNF43 is a HAP95 (AKAP8L) binding ubiquitin ligase that promotes cell growth and is upregulated in colon cancer.
- Poids moléculaire
- 86 kDa (MW of target protein)
- Pathways
- Signalisation WNT
-