RNF133 anticorps (N-Term)

N° du produit ABIN635910

Détail du produit anti-RNF133 anticorps

Antigène: RNF133 (Ring Finger Protein 133 (RNF133))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RNF133 est non-conjugé

Application: Western Blotting (WB)

Specificité: RNF133 antibody was raised against the N terminal of RNF133

Purification: Affinity purified

Immunogène: RNF133 antibody was raised using the N terminal of RNF133 corresponding to a region with amino acids VVWMAYMNISFHVGNHVLSELGETGVFGRSSTLKRVAGVIVPPEGKIQNA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RNF133 Blocking Peptide, catalog no. 33R-9908, is also available for use as a blocking control in assays to test for specificity of this RNF133 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF133 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RNF133

Antigène: RNF133 (Ring Finger Protein 133 (RNF133))

Autre désignation: RNF133 (RNF133 Produits)

Synonymes: anticorps Greul2, anticorps ring finger protein 133, anticorps RNF133, anticorps Rnf133

Sujet: RNF133 contains a RING finger domain, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions.

Poids moléculaire: 42 kDa (MW of target protein)