MTTP anticorps (N-Term)

N° du produit ABIN635912

Détail du produit anti-MTTP anticorps

Antigène: MTTP (Microsomal Triglyceride Transfer Protein (MTTP))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MTTP est non-conjugé

Application: Western Blotting (WB)

Specificité: MTTP antibody was raised against the N terminal of MTTP

Purification: Affinity purified

Immunogène: MTTP antibody was raised using the N terminal of MTTP corresponding to a region with amino acids MILLAVLFLCFISSYSASVKGHTTGLSLNNDRLYKLTYSTEVLLDRGKGK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MTTP Blocking Peptide, catalog no. 33R-6112, is also available for use as a blocking control in assays to test for specificity of this MTTP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTTP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MTTP

Antigène: MTTP (Microsomal Triglyceride Transfer Protein (MTTP))

Autre désignation: MTTP (MTTP Produits)

Synonymes: anticorps ABL, anticorps MTP, anticorps 1810043K16Rik, anticorps CG9342, anticorps CT3751, anticorps Dmel\\CG9342, anticorps dMTP, anticorps wu:fd36b01, anticorps zgc:111876, anticorps microsomal triglyceride transfer protein, anticorps Microsomal triacylglycerol transfer protein, anticorps MTTP, anticorps Mttp, anticorps Mtp, anticorps mttp

Sujet: MTP encodes the large subunit of the heterodimeric microsomal triglyceride transfer protein. Protein disulfide isomerase (PDI) completes the heterodimeric microsomal triglyceride transfer protein, which has been shown to play a central role in lipoprotein assembly. Mutations in MTP can cause abetalipoproteinemia.

Poids moléculaire: 97 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis