ACP2 anticorps (Middle Region)
-
- Antigène Voir toutes ACP2 Anticorps
- ACP2 (Acid Phosphatase 2, Lysosomal (ACP2))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Rat, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ACP2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ACP2 antibody was raised against the middle region of ACP2
- Purification
- Affinity purified
- Immunogène
- ACP2 antibody was raised using the middle region of ACP2 corresponding to a region with amino acids VPITEDRLLKFPLGPCPRYEQLQNETRQTPEYQNESSRNAQFLDMVANET
- Top Product
- Discover our top product ACP2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ACP2 Blocking Peptide, catalog no. 33R-9731, is also available for use as a blocking control in assays to test for specificity of this ACP2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACP2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ACP2 (Acid Phosphatase 2, Lysosomal (ACP2))
- Autre désignation
- ACP2 (ACP2 Produits)
- Synonymes
- anticorps ACP2, anticorps Acp-2, anticorps LAP, anticorps acid phosphatase 2, lysosomal, anticorps acid phosphatase 2, lysosomal S homeolog, anticorps ACP2, anticorps acp2, anticorps Acp2, anticorps acp2.S
- Sujet
- ACP2 is the beta subunit of lysosomal acid phosphatase (LAP). LAP is chemically and genetically distinct from red cell acid phosphatase. The protein belongs to a family of distinct isoenzymes which hydrolyze orthophosphoric monoesters to alcohol and phosphate. Mutations in this gene or in the related alpha subunit gene cause acid phosphatase deficiency.
- Poids moléculaire
- 45 kDa (MW of target protein)
-