ALG1 anticorps (N-Term)

N° du produit ABIN635919

Détail du produit anti-ALG1 anticorps

Antigène: ALG1 (Chitobiosyldiphosphodolichol beta-Mannosyltransferase (ALG1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ALG1 est non-conjugé

Application: Western Blotting (WB)

Specificité: ALG1 antibody was raised against the N terminal of ALG1

Purification: Affinity purified

Immunogène: ALG1 antibody was raised using the N terminal of ALG1 corresponding to a region with amino acids VVLGDVGRSPRMQYHALSLAMHGFSVTLLGFCNSKPHDELLQNNRIQIVG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ALG1 Blocking Peptide, catalog no. 33R-9885, is also available for use as a blocking control in assays to test for specificity of this ALG1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALG1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ALG1

Antigène: ALG1 (Chitobiosyldiphosphodolichol beta-Mannosyltransferase (ALG1))

Autre désignation: ALG1 (ALG1 Produits)

Sujet: ALG1 catalyzes the first mannosylation step in the biosynthesis of lipid-linked oligosaccharides. Defects in ALG1 are the cause of congenital disorder of glycosylation type 1K (CDG1K).

Poids moléculaire: 52 kDa (MW of target protein)