SLC8A3 anticorps
-
- Antigène Voir toutes SLC8A3 Anticorps
- SLC8A3 (Solute Carrier Family 8 (Sodium/calcium Exchanger), Member 3 (SLC8A3))
-
Reactivité
- Humain, Rat, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SLC8A3 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- SLC8 A3 antibody was raised using a synthetic peptide corresponding to a region with amino acids SAPEILLSLIEVCGHGFIAGDLGPSTIVGSAAFNMFIIIGICVYVIPDGE
- Top Product
- Discover our top product SLC8A3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLC8A3 Blocking Peptide, catalog no. 33R-8309, is also available for use as a blocking control in assays to test for specificity of this SLC8A3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SLC8A3 (Solute Carrier Family 8 (Sodium/calcium Exchanger), Member 3 (SLC8A3))
- Autre désignation
- SLC8A3 (SLC8A3 Produits)
- Synonymes
- anticorps SLC8A3, anticorps NCX3, anticorps Ncx3, anticorps AW742262, anticorps solute carrier family 8 member A3, anticorps solute carrier family 8 (sodium/calcium exchanger), member 3, anticorps SLC8A3, anticorps slc8a3, anticorps Slc8a3
- Sujet
- SLC8A3 is a member of the sodium/calcium exchanger integral membrane protein family. Three mammalian isoforms in family 8 have been identified. Na+/Ca2+ exchange proteins are involved in maintaining Ca2+ homeostasis in a wide variety of cell types. The protein is regulated by intracellular calcium ions and is found in both the plasma membrane and intracellular organellar membranes, where exchange of Na+ for Ca2+ occurs in an electrogenic manner.
- Poids moléculaire
- 103 kDa (MW of target protein)
-