DNAJB11 anticorps

N° du produit ABIN635926

Détail du produit anti-DNAJB11 anticorps

Antigène: DNAJB11 (DnaJ (Hsp40) Homolog, Subfamily B, Member 11 (DNAJB11))

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DNAJB11 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: DNAJB11 antibody was raised using a synthetic peptide corresponding to a region with amino acids FDNNNIKGSLIITFDVDFPKEQLTEEAREGIKQLLKQGSVQKVYNGLQGY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DNAJB11 Blocking Peptide, catalog no. 33R-2868, is also available for use as a blocking control in assays to test for specificity of this DNAJB11 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DNAJB11 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DNAJB11

Antigène: DNAJB11 (DnaJ (Hsp40) Homolog, Subfamily B, Member 11 (DNAJB11))

Autre désignation: DNAJB11 (DNAJB11 Produits)

Synonymes: anticorps MGC75796, anticorps MGC81924, anticorps ABBP-2, anticorps ABBP2, anticorps DJ9, anticorps Dj-9, anticorps EDJ, anticorps ERdj3, anticorps ERj3, anticorps ERj3p, anticorps PRO1080, anticorps UNQ537, anticorps hDj-9, anticorps 1810031F23Rik, anticorps AL024055, anticorps Dj9, anticorps LRRGT00084, anticorps cb954, anticorps DnaJ heat shock protein family (Hsp40) member B11, anticorps DnaJ heat shock protein family (Hsp40) member B11 S homeolog, anticorps DnaJ (Hsp40) homolog, subfamily B, member 11, anticorps dnajb11, anticorps DNAJB11, anticorps dnajb11.S, anticorps Dnajb11

Sujet: DNAJB11 belongs to the evolutionarily conserved DNAJ/HSP40 family of proteins, which regulate molecular chaperone activity by stimulating ATPase activity. DNAJ proteins may have up to 3 distinct domains: a conserved 70-amino acid J domain, usually at the N terminus, a glycine/phenylalanine (G/F)-rich region, and a C-terminal cysteine-rich region.

Poids moléculaire: 40 kDa (MW of target protein)

Pathways: ER-Nucleus Signaling