C12orf49 anticorps (C-Term)

N° du produit ABIN635928

Détail du produit anti-C12orf49 anticorps

Antigène: C12orf49 (Chromosome 12 Open Reading Frame 49 (C12orf49))

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C12orf49 est non-conjugé

Application: Western Blotting (WB)

Specificité: C12 ORF49 antibody was raised against the C terminal Of C12 rf49

Purification: Affinity purified

Immunogène: C12 ORF49 antibody was raised using the C terminal Of C12 rf49 corresponding to a region with amino acids LERFLNRAAVAFQNLFMAVEDHFELCLAKCRTSSQSVQHENTYRDPIAKY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C12ORF49 Blocking Peptide, catalog no. 33R-4924, is also available for use as a blocking control in assays to test for specificity of this C12ORF49 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF49 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C12orf49

Antigène: C12orf49 (Chromosome 12 Open Reading Frame 49 (C12orf49))

Autre désignation: C12ORF49 (C12orf49 Produits)

Synonymes: anticorps C12orf49, anticorps chromosome 12 open reading frame 49, anticorps chromosome 17 open reading frame, human C12orf49, anticorps chromosome 15 C12orf49 homolog, anticorps chromosome 12 open reading frame 49 S homeolog, anticorps RIKEN cDNA 2410131K14 gene, anticorps zgc:110063, anticorps C12orf49, anticorps C17H12orf49, anticorps C15H12orf49, anticorps c12orf49.S, anticorps c12orf49, anticorps 2410131K14Rik, anticorps zgc:110063

Sujet: The function of C12orf49 protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 23 kDa (MW of target protein)